SCOPe 2.01: Domain d2hofb2: 2hof B:130-341

Lineage for d2hofb2 (2hof B:130-341)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d2hofb2: 2hof B:130-341 [147316]
   Other proteins in same PDB: d2hofa1, d2hofb1
   automatically matched to d1crxa2
   protein/DNA complex

Details for d2hofb2

PDB Entry: 2hof, 2.4 Å

PDB Description: crystal structure of the pre-cleavage synaptic complex in the cre-loxp site-specific recombination

PDB Compounds: (B:) Recombinase cre

SCOPe Domain Sequences for d2hofb2:

Sequence, based on SEQRES records:

>d2hofb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtatlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Sequence, based on observed residues (ATOM records):

>d2hofb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtatlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnamvrlled

Timeline for d2hofb2:

• d2hofb2 first appeared in SCOP 1.75
  
• d2hofb2 appears in SCOPe 2.02
  
• d2hofb2 appears in the current release, SCOPe 2.08