Lineage for d2hkaa_ (2hka A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765571Family b.1.18.7: ML domain [81287] (3 proteins)
    implicated in lipid recognition, particularly in the recognition of pathogen related products
    automatically mapped to Pfam PF02221
  6. 2765572Protein Epididymal secretory protein E1 (Niemann-Pick C2 protein) [81964] (1 species)
    a cholesterol binding protein
  7. 2765573Species Cow (Bos taurus) [TaxId:9913] [81965] (2 PDB entries)
  8. 2765575Domain d2hkaa_: 2hka A: [147298]
    automated match to d1nepa_
    complexed with act, c3s, gol, nag, so4

Details for d2hkaa_

PDB Entry: 2hka (more details), 1.81 Å

PDB Description: crystal structure of bovine npc2 and cholesterol sulfate complex
PDB Compounds: (A:) Epididymal secretory protein E1

SCOPe Domain Sequences for d2hkaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hkaa_ b.1.18.7 (A:) Epididymal secretory protein E1 (Niemann-Pick C2 protein) {Cow (Bos taurus) [TaxId: 9913]}
epvkfkdcgswvgvikevnvspcptqpcklhrgqsysvnvtftsntqsqsskavvhgivm
gipvpfpipesdgcksgircpiekdktynyvnklpvkneypsikvvveweltddknqrff
cwqipievea

SCOPe Domain Coordinates for d2hkaa_:

Click to download the PDB-style file with coordinates for d2hkaa_.
(The format of our PDB-style files is described here.)

Timeline for d2hkaa_: