SCOP 1.75: Domain d2hbaa1: 2hba A:1-52

Lineage for d2hbaa1 (2hba A:1-52)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
   beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha

4. Superfamily d.100.1: L9 N-domain-like [55658] (2 families)

5. Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)

6. Protein Ribosomal protein L9 N-domain [55660] (3 species)

7. Species Bacillus stearothermophilus [TaxId:1422] [55661] (9 PDB entries)

8. Domain d2hbaa1: 2hba A:1-52 [147253]
   complexed with cl, imd, zn; mutant

Details for d2hbaa1

PDB Entry: 2hba, 1.25 Å

PDB Description: crystal structure of n-terminal domain of ribosomal protein l9 (ntl9) k12m

PDB Compounds: (A:) 50S ribosomal protein L9

SCOP Domain Sequences for d2hbaa1:

Sequence; same for both SEQRES and ATOM records:

>d2hbaa1 d.100.1.1 (A:1-52) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}
mkviflkdvkgmgkkgeiknvadgyannflfkqglaieatpanlkaleaqkq

Timeline for d2hbaa1:

• d2hbaa1 is new in SCOP 1.75
  
• d2hbaa1 appears in SCOPe 2.01
  
• d2hbaa1 appears in the current release, SCOPe 2.08