SCOP 1.75: Domain d2h8ha3: 2h8h A:249-529

Lineage for d2h8ha3 (2h8h A:249-529)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (63 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein c-src tyrosine kinase [56155] (2 species)
   PTK group; Src subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [56156] (8 PDB entries)

8. Domain d2h8ha3: 2h8h A:249-529 [147242]
   Other proteins in same PDB: d2h8ha1, d2h8ha2
   automatically matched to d1kswa3
   complexed with h8h

Details for d2h8ha3

PDB Entry: 2h8h, 2.2 Å

PDB Description: src kinase in complex with a quinazoline inhibitor

PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOP Domain Sequences for d2h8ha3:

Sequence; same for both SEQRES and ATOM records:

>d2h8ha3 d.144.1.7 (A:249-529) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
kpqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeafl
qeaqvmkklrheklvqlyavvseepiyivteymskgslldflkgetgkylrlpqlvdmaa
qiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpikw
tapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppecp
eslhdlmcqcwrkepeerptfeylqafledyftstepqyqp

Timeline for d2h8ha3:

• d2h8ha3 is new in SCOP 1.75
  
• d2h8ha3 appears in SCOPe 2.01
  
• d2h8ha3 appears in the current release, SCOPe 2.08