Class a: All alpha proteins [46456] (284 folds) |
Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) |
Family a.60.1.3: Variant SAM domain [158526] (2 proteins) shares a sequence motif with Pfam PF07647, but has a distinct packing of helices |
Protein Deleted in Liver Cancer 2, DLC2 [158527] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158528] (2 PDB entries) Uniprot Q9Y3M8 50-120 |
Domain d2h80a1: 2h80 A:11-81 [147238] |
PDB Entry: 2h80 (more details)
SCOPe Domain Sequences for d2h80a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h80a1 a.60.1.3 (A:11-81) Deleted in Liver Cancer 2, DLC2 {Human (Homo sapiens) [TaxId: 9606]} lvprgsqeieakeacdwlraagfpqyaqlyedsqfpinivavkndhdflekdlveplcrr lntlnkcasmk
Timeline for d2h80a1: