Lineage for d2h80a1 (2h80 A:11-81)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272162Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) (S)
  5. 1272276Family a.60.1.3: Variant SAM domain [158526] (2 proteins)
    shares a sequence motif with Pfam PF07647, but has a distinct packing of helices
  6. 1272281Protein Deleted in Liver Cancer 2, DLC2 [158527] (1 species)
  7. 1272282Species Human (Homo sapiens) [TaxId:9606] [158528] (2 PDB entries)
    Uniprot Q9Y3M8 50-120
  8. 1272283Domain d2h80a1: 2h80 A:11-81 [147238]

Details for d2h80a1

PDB Entry: 2h80 (more details)

PDB Description: nmr structures of sam domain of deleted in liver cancer 2 (dlc2)
PDB Compounds: (A:) StAR-related lipid transfer protein 13

SCOPe Domain Sequences for d2h80a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h80a1 a.60.1.3 (A:11-81) Deleted in Liver Cancer 2, DLC2 {Human (Homo sapiens) [TaxId: 9606]}
lvprgsqeieakeacdwlraagfpqyaqlyedsqfpinivavkndhdflekdlveplcrr
lntlnkcasmk

SCOPe Domain Coordinates for d2h80a1:

Click to download the PDB-style file with coordinates for d2h80a1.
(The format of our PDB-style files is described here.)

Timeline for d2h80a1: