Lineage for d2gzja_ (2gzj A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912781Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 912866Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family) (S)
  5. 912867Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins)
  6. 912891Protein ImmE9 protein (Im9) [47351] (1 species)
  7. 912892Species Escherichia coli [TaxId:562] [47352] (17 PDB entries)
  8. 912896Domain d2gzja_: 2gzj A: [147204]
    Other proteins in same PDB: d2gzjb_, d2gzjf_
    automated match to d1e0ha_
    protein/DNA complex; complexed with po4, zn; mutant

Details for d2gzja_

PDB Entry: 2gzj (more details), 1.6 Å

PDB Description: crystal structure of the e9 dnase domain with a mutant immunity protein im9 (d51a)
PDB Compounds: (A:) colicin-e9 immunity protein

SCOPe Domain Sequences for d2gzja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gzja_ a.28.2.1 (A:) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsaliyypkegddd
spsgivntvkqwraangksgfkq

SCOPe Domain Coordinates for d2gzja_:

Click to download the PDB-style file with coordinates for d2gzja_.
(The format of our PDB-style files is described here.)

Timeline for d2gzja_: