SCOP 1.75: Domain d2gzja1: 2gzj A:3-85

Lineage for d2gzja1 (2gzj A:3-85)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.2: Colicin E immunity proteins [47345] (1 family)

5. Family a.28.2.1: Colicin E immunity proteins [47346] (3 proteins)

6. Protein ImmE9 protein (Im9) [47351] (1 species)

7. Species Escherichia coli [TaxId:562] [47352] (12 PDB entries)

8. Domain d2gzja1: 2gzj A:3-85 [147204]
   Other proteins in same PDB: d2gzjb1, d2gzjf1
   automatically matched to 2GYK A:3-85
   complexed with po4, zn; mutant

Details for d2gzja1

PDB Entry: 2gzj, 1.6 Å

PDB Description: crystal structure of the e9 dnase domain with a mutant immunity protein im9 (d51a)

PDB Compounds: (A:) colicin-e9 immunity protein

SCOP Domain Sequences for d2gzja1:

Sequence; same for both SEQRES and ATOM records:

>d2gzja1 a.28.2.1 (A:3-85) ImmE9 protein (Im9) {Escherichia coli [TaxId: 562]}
lkhsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsaliyypkegddd
spsgivntvkqwraangksgfkq

Timeline for d2gzja1:

• d2gzja1 is new in SCOP 1.75
  
• d2gzja1 is called d2gzja_ in SCOPe 2.01
  
• d2gzja1 appears in the current release, SCOPe 2.08, called d2gzja_