Lineage for d2gz4d1 (2gz4 D:8-204)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 780219Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 780220Superfamily a.211.1: HD-domain/PDEase-like [109604] (5 families) (S)
  5. 780221Family a.211.1.1: HD domain [101340] (13 proteins)
    Pfam PF01966; metal dependent phosphohydrolases
  6. 780236Protein Hypothetical protein Atu1052 [158725] (1 species)
  7. 780237Species Agrobacterium tumefaciens [TaxId:358] [158726] (1 PDB entry)
    Uniprot Q8UGI5 6-205
  8. 780241Domain d2gz4d1: 2gz4 D:8-204 [147199]
    automatically matched to 2GZ4 A:6-205

Details for d2gz4d1

PDB Entry: 2gz4 (more details), 1.5 Å

PDB Description: 1.5 A Crystal Structure of a Protein of Unknown Function ATU1052 from Agrobacterium tumefaciens
PDB Compounds: (D:) Hypothetical protein Atu1052

SCOP Domain Sequences for d2gz4d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gz4d1 a.211.1.1 (D:8-204) Hypothetical protein Atu1052 {Agrobacterium tumefaciens [TaxId: 358]}
rawqrmlsgrrldlldpspldveiadiahglarvarwngqtrgdhaftvaqhclivetif
crmcpgatpdemqmallhdapeyvigdmispfksvvgggyktvekrleaavhlrfglpph
asrelkdrikkadtvaaffeatelagfstaeaqkffglprgitrdmfdiiplpsteaqrl
fiarfeaietlrvtrtg

SCOP Domain Coordinates for d2gz4d1:

Click to download the PDB-style file with coordinates for d2gz4d1.
(The format of our PDB-style files is described here.)

Timeline for d2gz4d1: