Lineage for d2gsce1 (2gsc E:10-121)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 767485Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 767791Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family) (S)
    IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel
  5. 767792Family a.29.16.1: IVS-encoded protein-like [158447] (2 proteins)
    Pfam PF05635
  6. 767800Protein Uncharacterized protein XCC0516 [158448] (1 species)
  7. 767801Species Xanthomonas campestris pv. campestris [TaxId:340] [158449] (1 PDB entry)
    Uniprot Q8PD29 9-125
  8. 767806Domain d2gsce1: 2gsc E:10-121 [147173]
    automatically matched to 2GSC A:9-125

Details for d2gsce1

PDB Entry: 2gsc (more details), 2.45 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Cytosolic Protein Xcc0516 from Xanthomonas campestris
PDB Compounds: (E:) Putative uncharacterized protein XCC0516

SCOP Domain Sequences for d2gsce1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gsce1 a.29.16.1 (E:10-121) Uncharacterized protein XCC0516 {Xanthomonas campestris pv. campestris [TaxId: 340]}
pherldawrdsmelvemiyrltevfpdqerygltaqlrraavsipsniaegaarrstpdy
srflsiargslseldtqvqiaarlgysrseddqsvrrqvdlvfakltalmna

SCOP Domain Coordinates for d2gsce1:

Click to download the PDB-style file with coordinates for d2gsce1.
(The format of our PDB-style files is described here.)

Timeline for d2gsce1: