SCOPe 2.02: Domain d2gscb_: 2gsc B:

Lineage for d2gscb_ (2gsc B:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.16: IVS-encoded protein-like [158446] (1 family)
   IVS: Intervening sequence with conserved ORF in eubacterial 23S rRNA genes; forms a homopentamer with a toroid-shaped structure containing a tapered central channel

5. Family a.29.16.1: IVS-encoded protein-like [158447] (3 proteins)
   Pfam PF05635

6. Protein automated matches [190667] (1 species)
   not a true protein

7. Species Xanthomonas campestris pv. campestris [TaxId:340] [187769] (1 PDB entry)

8. Domain d2gscb_: 2gsc B: [147170]
   Other proteins in same PDB: d2gsca1
   automated match to d2gsca1

Details for d2gscb_

PDB Entry: 2gsc, 2.45 Å

PDB Description: Crystal Structure of the Conserved Hypothetical Cytosolic Protein Xcc0516 from Xanthomonas campestris

PDB Compounds: (B:) Putative uncharacterized protein XCC0516

SCOPe Domain Sequences for d2gscb_:

Sequence; same for both SEQRES and ATOM records:

>d2gscb_ a.29.16.1 (B:) automated matches {Xanthomonas campestris pv. campestris [TaxId: 340]}
aqrpherldawrdsmelvemiyrltevfpdqerygltaqlrraavsipsniaegaarrst
pdysrflsiargslseldtqvqiaarlgysrseddqsvrrqvdlvfakltalmnalr

Timeline for d2gscb_:

• d2gscb_ first appeared in SCOP 1.75, called d2gscb1
  
• d2gscb_ appears in SCOPe 2.01
  
• d2gscb_ appears in SCOPe 2.03
  
• d2gscb_ appears in the current release, SCOPe 2.08