Lineage for d2grpb1 (2grp B:431-587)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 776072Superfamily a.118.12: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69099] (1 family) (S)
  5. 776073Family a.118.12.1: Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69100] (1 protein)
  6. 776074Protein Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain [69101] (2 species)
  7. 776075Species Human (Homo sapiens) [TaxId:9606] [158788] (9 PDB entries)
    Uniprot P46060 431-587! Uniprot P46060 432-587
  8. 776080Domain d2grpb1: 2grp B:431-587 [147166]
    automatically matched to 2GRN B:431-587
    mutant

Details for d2grpb1

PDB Entry: 2grp (more details), 2.05 Å

PDB Description: crystal structure of human rangap1-ubc9-y87a
PDB Compounds: (B:) ran gtpase-activating protein 1

SCOP Domain Sequences for d2grpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2grpb1 a.118.12.1 (B:431-587) Ran-GTPase activating protein 1 (RanGAP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
padvstflafpspekllrlgpkssvliaqqtdtsdpekvvsaflkvssvfkdeatvrmav
qdavdalmqkafnsssfnsntfltrllvhmgllksedkvkaianlygplmalnhmvqqdy
fpkalaplllafvtkpnsalescsfarhsllqtlykv

SCOP Domain Coordinates for d2grpb1:

Click to download the PDB-style file with coordinates for d2grpb1.
(The format of our PDB-style files is described here.)

Timeline for d2grpb1: