SCOPe 2.05: Domain d2goma1: 2gom A:105-165

Lineage for d2goma1 (2gom A:105-165)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.17: Efb C-domain-like [158366] (1 family)
   automatically mapped to Pfam PF12199

5. Family a.7.17.1: Efb C-domain-like [158367] (2 proteins)
   PfamB PB008033
   this is a repeat family; one repeat unit is 2gom A:105-165 found in domain

6. Protein Fibrinogen-binding protein Efb (Fib) [158368] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [158369] (4 PDB entries)
   Uniprot A6QG59 101-165! Uniprot P68798 105-165! Uniprot P68799 101-165

8. Domain d2goma1: 2gom A:105-165 [147149]

Details for d2goma1

PDB Entry: 2gom, 1.25 Å

PDB Description: Crystal structure of Efb-C from Staphylococcus aureus

PDB Compounds: (A:) Fibrinogen-binding protein

SCOPe Domain Sequences for d2goma1:

Sequence; same for both SEQRES and ATOM records:

>d2goma1 a.7.17.1 (A:105-165) Fibrinogen-binding protein Efb (Fib) {Staphylococcus aureus [TaxId: 1280]}
ikkeqkliqaqnlvrefekthtvsahrkaqkavnlvsfeykvkkmvlqeridnvlkqglv
r

Timeline for d2goma1:

• d2goma1 first appeared in SCOP 1.75
  
• d2goma1 appears in SCOPe 2.04
  
• d2goma1 appears in SCOPe 2.06
  
• d2goma1 appears in the current release, SCOPe 2.08