Lineage for d2gmga1 (2gmg A:1-105)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1722841Family a.4.5.82: PF0610-like [158332] (1 protein)
    PfamB PB016993; insertion of a zinc-ribbon subdomain in the beta-hairpin "wing"
  6. 1722842Protein Hypothetical protein PF0610 [158333] (1 species)
  7. 1722843Species Pyrococcus furiosus [TaxId:2261] [158334] (1 PDB entry)
    Uniprot Q8U362 1-105
  8. 1722844Domain d2gmga1: 2gmg A:1-105 [147131]

Details for d2gmga1

PDB Entry: 2gmg (more details)

PDB Description: Solution NMR Structure of protein PF0610 from Pyrococcus furiosus, Northeast Structural Genomics Consortium Target PfG3
PDB Compounds: (A:) hypothetical protein Pf0610

SCOPe Domain Sequences for d2gmga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gmga1 a.4.5.82 (A:1-105) Hypothetical protein PF0610 {Pyrococcus furiosus [TaxId: 2261]}
ahhhhhhgsatrrekiielllegdyspselarildmrgkgskkviledlkviskiakreg
mvllikpaqcrkcgfvfkaeinipsrcpkcksewieeprfklerk

SCOPe Domain Coordinates for d2gmga1:

Click to download the PDB-style file with coordinates for d2gmga1.
(The format of our PDB-style files is described here.)

Timeline for d2gmga1: