Lineage for d2g8za2 (2g8z A:240-307)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2185704Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2186175Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2186176Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2186324Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2186357Species Sheep (Ovis aries) [TaxId:9940] [109621] (17 PDB entries)
    Uniprot Q6TMG6
  8. 2186366Domain d2g8za2: 2g8z A:240-307 [147096]
    Other proteins in same PDB: d2g8za1
    automatically matched to d1ljya2
    complexed with man

Details for d2g8za2

PDB Entry: 2g8z (more details), 2.5 Å

PDB Description: crystal structure of the ternary complex of signalling protein from sheep (sps-40) with trimer and designed peptide at 2.5a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2g8za2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g8za2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOPe Domain Coordinates for d2g8za2:

Click to download the PDB-style file with coordinates for d2g8za2.
(The format of our PDB-style files is described here.)

Timeline for d2g8za2: