| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88572] (46 PDB entries) |
| Domain d2g75b2: 2g75 B:109-211 [147089] Other proteins in same PDB: d2g75a1, d2g75a2, d2g75b1, d2g75c1, d2g75c2, d2g75d1 automated match to d2dd8l2 |
PDB Entry: 2g75 (more details), 2.28 Å
SCOPe Domain Sequences for d2g75b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2g75b2 b.1.1.2 (B:109-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]}
qpkanptvtlfppsseefqankatlvclisdfypgavtvawkadgspvkagvettkpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte
Timeline for d2g75b2: