SCOPe 2.05: Domain d2g75a2: 2g75 A:114-214

Lineage for d2g75a2 (2g75 A:114-214)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2g75a2: 2g75 A:114-214 [147087]
   Other proteins in same PDB: d2g75a1, d2g75b1, d2g75b2, d2g75c1, d2g75d1, d2g75d2
   automated match to d2dd8h2

Details for d2g75a2

PDB Entry: 2g75, 2.28 Å

PDB Description: Crystal Structure of anti-SARS m396 Antibody

PDB Compounds: (A:) IGG Heavy chain

SCOPe Domain Sequences for d2g75a2:

Sequence; same for both SEQRES and ATOM records:

>d2g75a2 b.1.1.2 (A:114-214) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtsalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d2g75a2:

• d2g75a2 first appeared in SCOP 1.75
  
• d2g75a2 appears in SCOPe 2.04
  
• d2g75a2 appears in SCOPe 2.06
  
• d2g75a2 appears in the current release, SCOPe 2.08