Lineage for d2g75a1 (2g75 A:2-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1755760Species Human (Homo sapiens), cluster 1 [TaxId:9606] [88544] (37 PDB entries)
  8. 1755791Domain d2g75a1: 2g75 A:2-113 [147086]
    Other proteins in same PDB: d2g75a2, d2g75b1, d2g75b2, d2g75c2, d2g75d1, d2g75d2
    automated match to d2dd8h1

Details for d2g75a1

PDB Entry: 2g75 (more details), 2.28 Å

PDB Description: Crystal Structure of anti-SARS m396 Antibody
PDB Compounds: (A:) IGG Heavy chain

SCOPe Domain Sequences for d2g75a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g75a1 b.1.1.1 (A:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]}
vqlqqsgaevkkpgssvkvsckasggtfssytiswvrqapgqglewmggitpilgianya
qkfqgrvtittdeststaymelsslrsedtavyycardtvmggmdvwgqgttvtvss

SCOPe Domain Coordinates for d2g75a1:

Click to download the PDB-style file with coordinates for d2g75a1.
(The format of our PDB-style files is described here.)

Timeline for d2g75a1: