Lineage for d2g41a2 (2g41 A:240-307)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1899919Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 1900344Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 1900345Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 1900493Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 1900525Species Sheep (Ovis aries) [TaxId:9940] [109621] (11 PDB entries)
    Uniprot Q6TMG6
  8. 1900532Domain d2g41a2: 2g41 A:240-307 [147080]
    Other proteins in same PDB: d2g41a1
    automatically matched to d1ljya2
    complexed with nag

Details for d2g41a2

PDB Entry: 2g41 (more details), 3 Å

PDB Description: crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0a resolution
PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d2g41a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2g41a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOPe Domain Coordinates for d2g41a2:

Click to download the PDB-style file with coordinates for d2g41a2.
(The format of our PDB-style files is described here.)

Timeline for d2g41a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2g41a1