SCOPe 2.08: Domain d2g41a1: 2g41 A:1-239,A:308-362

Lineage for d2g41a1 (2g41 A:1-239,A:308-362)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Signal processing protein (SPC-40, MGP-40) [89480] (5 species)
   secreted during involution

7. Species Sheep (Ovis aries) [TaxId:9940] [109611] (17 PDB entries)
   Uniprot Q6TMG6

8. Domain d2g41a1: 2g41 A:1-239,A:308-362 [147079]
   Other proteins in same PDB: d2g41a2
   automatically matched to d1ljya1

Details for d2g41a1

PDB Entry: 2g41, 3 Å

PDB Description: crystal structure of the complex of sheep signalling glycoprotein with chitin trimer at 3.0a resolution

PDB Compounds: (A:) signal processing protein

SCOPe Domain Sequences for d2g41a1:

Sequence; same for both SEQRES and ATOM records:

>d2g41a1 c.1.8.5 (A:1-239,A:308-362) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
yklicyytswsqyregdgscfpdaidpflcthviysfanisnneidtwewndvtlydtln
tlknrnpklktllsvggwnfgperfsaiasktqsrrtfiksvppflrthgfdgldlawly
pgrrdkrhlttlvkemkaefireaqagteqlllsaavsagkiaidrgydiaqisrhldfi
slltydfhgawrqtvghhsplfagnedassrfsnadyavsymlrlgapanklvmgiptXd
dqesvknkarylknrqlagamvwaldlddfrgtfcgqnltfpltsavkdvlaev

Timeline for d2g41a1:

• d2g41a1 first appeared in SCOP 1.75
  
• d2g41a1 appears in SCOPe 2.07