SCOP 1.75: Domain d2g0ee2: 2g0e E:73-187

Lineage for d2g0ee2 (2g0e E:73-187)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (1 family)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (34 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (20 PDB entries)
   Uniprot P23217

8. Domain d2g0ee2: 2g0e E:73-187 [147065]
   Other proteins in same PDB: d2g0ea1, d2g0eb1, d2g0ed1, d2g0ee1
   automatically matched to d1jt0a2
   complexed with cgq, so4

Details for d2g0ee2

PDB Entry: 2g0e, 2.88 Å

PDB Description: Structure of QacR Multidrug Transcriptional Regulator Bound to Trivalent and Bivalent Diamidine Drugs

PDB Compounds: (E:) HTH-type transcriptional regulator qacR

SCOP Domain Sequences for d2g0ee2:

Sequence; same for both SEQRES and ATOM records:

>d2g0ee2 a.121.1.1 (E:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d2g0ee2:

• d2g0ee2 is new in SCOP 1.75
  
• d2g0ee2 appears in SCOPe 2.01
  
• d2g0ee2 appears in the current release, SCOPe 2.08