Class b: All beta proteins [48724] (176 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
Protein Pullulanase PulA [159262] (1 species) |
Species Klebsiella pneumoniae [TaxId:573] [159263] (6 PDB entries) Uniprot P07206 973-1090 |
Domain d2fhfa4: 2fhf A:966-1083 [147038] Other proteins in same PDB: d2fhfa1, d2fhfa2, d2fhfa3, d2fhfa5 complexed with ca |
PDB Entry: 2fhf (more details), 1.65 Å
SCOPe Domain Sequences for d2fhfa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fhfa4 b.71.1.1 (A:966-1083) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} dgatvmkrvdfrntgadqqtgllvmtiddgmqagasldsrvdgivvainaapesrtlqdf agtslqlsaiqqaagdrslasgvqvaadgsvtlpawsvavlelpqgesqgaglpvssk
Timeline for d2fhfa4:
View in 3D Domains from same chain: (mouse over for more information) d2fhfa1, d2fhfa2, d2fhfa3, d2fhfa5 |