SCOPe 2.06: Domain d2fhba3: 2fhb A:32-162

Lineage for d2fhba3 (2fhb A:32-162)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (4 families)

5. Family b.3.1.3: PUD-like [158932] (1 protein)
   Pfam PF03714; bacterial pullanase-associated domain

6. Protein Pullulanase PulA [158933] (4 species)

7. Species Klebsiella pneumoniae [TaxId:573] [158934] (3 PDB entries)
   Uniprot P07206 39-169

8. Domain d2fhba3: 2fhb A:32-162 [147027]
   Other proteins in same PDB: d2fhba1, d2fhba2, d2fhba4, d2fhba5
   automated match to d2fhfa3
   complexed with ca

Details for d2fhba3

PDB Entry: 2fhb, 1.8 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhba3:

Sequence; same for both SEQRES and ATOM records:

>d2fhba3 b.3.1.3 (A:32-162) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
dvvvrlpdvavpgeavqasarqavihlvdiagitsstpadyatknlylwnnetcdalsap
vadwndvsttptgsdkygpywvipltkesgcinvivrdgtnklidsdlrvsfsdftdrtv
sviagnsavyd

Timeline for d2fhba3:

• d2fhba3 first appeared in SCOP 1.75
  
• d2fhba3 appears in SCOPe 2.05
  
• d2fhba3 appears in SCOPe 2.07
  
• d2fhba3 appears in the current release, SCOPe 2.08