SCOPe 2.05: Domain d2fhba1: 2fhb A:288-402

Lineage for d2fhba1 (2fhb A:288-402)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.2: E-set domains of sugar-utilizing enzymes [81282] (20 proteins)
   domains of unknown function associated with different type of catalytic domains in a different sequential location
   subgroup of the larger IPT/TIG domain family

6. Protein Pullulanase PulA [158883] (1 species)
   contains two E-set domains in tandem

7. Species Klebsiella pneumoniae [TaxId:573] [158884] (6 PDB entries)
   Uniprot P07206 170-294! Uniprot P07206 295-409

8. Domain d2fhba1: 2fhb A:288-402 [147025]
   Other proteins in same PDB: d2fhba3, d2fhba4, d2fhba5
   automated match to d2fhfa1
   complexed with ca

Details for d2fhba1

PDB Entry: 2fhb, 1.8 Å

PDB Description: crystal structure analysis of klebsiella pneumoniae pullulanase complexed with maltose

PDB Compounds: (A:) pullulanase

SCOPe Domain Sequences for d2fhba1:

Sequence; same for both SEQRES and ATOM records:

>d2fhba1 b.1.18.2 (A:288-402) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]}
yaaaaealsygaqltdsgvtfrvwaptaqqvelviysadkkviashpmtrdsasgawswq
ggsdlkgafyryamtvyhpqsrkveqyevtdpyahslstnseysqvvdlndsalk

Timeline for d2fhba1:

• d2fhba1 first appeared in SCOP 1.75
  
• d2fhba1 appears in SCOPe 2.04
  
• d2fhba1 appears in SCOPe 2.06
  
• d2fhba1 appears in the current release, SCOPe 2.08