SCOPe 2.04: Domain d2fc3a1: 2fc3 A:4-127

Lineage for d2fc3a1 (2fc3 A:4-127)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.3: L30e-like [55315] (4 families)

5. Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins)

6. Protein Ribosomal protein L7ae [55319] (7 species)

7. Species Aeropyrum pernix [TaxId:56636] [160501] (1 PDB entry)
   Uniprot Q9YAX7 4-127

8. Domain d2fc3a1: 2fc3 A:4-127 [147019]

Details for d2fc3a1

PDB Entry: 2fc3, 1.56 Å

PDB Description: crystal structure of the extremely thermostable aeropyrum pernix l7ae multifunctional protein

PDB Compounds: (A:) 50S ribosomal protein L7Ae

SCOPe Domain Sequences for d2fc3a1:

Sequence; same for both SEQRES and ATOM records:

>d2fc3a1 d.79.3.1 (A:4-127) Ribosomal protein L7ae {Aeropyrum pernix [TaxId: 56636]}
piyvrfevpedlaekayeavkraretgrikkgtnettkaverglaklvviaedvdppeiv
mhlpllcdekkipyvyvpskkrlgeaagievaaasvaiiepgdaetlvreivekvkelra
kagv

Timeline for d2fc3a1:

• d2fc3a1 first appeared in SCOP 1.75
  
• d2fc3a1 appears in SCOPe 2.03
  
• d2fc3a1 appears in SCOPe 2.05
  
• d2fc3a1 appears in the current release, SCOPe 2.08