SCOPe 2.04: Domain d2fatl1: 2fat L:1-106A

Lineage for d2fatl1 (2fat L:1-106A)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d2fatl1: 2fat L:1-106A [147017]
   Other proteins in same PDB: d2fath1, d2fath2, d2fatl2
   automated match to d1h3pl1

Details for d2fatl1

PDB Entry: 2fat, 1.77 Å

PDB Description: An anti-urokinase plasminogen activator receptor (UPAR) antibody: Crystal structure and binding epitope

PDB Compounds: (L:) FAB ATN-615, light chain

SCOPe Domain Sequences for d2fatl1:

Sequence; same for both SEQRES and ATOM records:

>d2fatl1 b.1.1.0 (L:1-106A) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspditaaslgqkvtitcsasssvsymhwyqqksgtspkpwifeisklasgvpar
fsgsgsgtsysltissmeaedaaiyycqqwnypftfgggtkleik

Timeline for d2fatl1:

• d2fatl1 first appeared in SCOP 1.75
  
• d2fatl1 appears in SCOPe 2.03
  
• d2fatl1 appears in SCOPe 2.05
  
• d2fatl1 appears in the current release, SCOPe 2.08