SCOP 1.75: Domain d2fath1: 2fat H:1-113

Lineage for d2fath1 (2fat H:1-113)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E
   SQ NA # humanized antibody
   Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor
   Uniprot P01750 20-116 #
   HV06_MOUSE Ig heavy chain V region 102 precursor
   Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor

8. Domain d2fath1: 2fat H:1-113 [147015]
   Other proteins in same PDB: d2fath2, d2fatl1, d2fatl2
   automatically matched to 2FD6 H:1-113

Details for d2fath1

PDB Entry: 2fat, 1.77 Å

PDB Description: An anti-urokinase plasminogen activator receptor (UPAR) antibody: Crystal structure and binding epitope

PDB Compounds: (H:) FAB ATN-615, heavy chain

SCOP Domain Sequences for d2fath1:

Sequence; same for both SEQRES and ATOM records:

>d2fath1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
gvklqqsgpevvkpgasvkisckasgysftnfyihwvkqrpgqglewigwifhgsdntey
nekfkdkatltadtssstaymqlssltsedsavyfcarwgphwyfdvwgqgttvtvss

Timeline for d2fath1:

• d2fath1 is new in SCOP 1.75
  
• d2fath1 appears in SCOPe 2.01
  
• d2fath1 last appears in SCOPe 2.07