SCOPe 2.05: Domain d2f15a1: 2f15 A:75-163

Lineage for d2f15a1 (2f15 A:75-163)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (24 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
   lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)

6. Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158888] (1 PDB entry)
   Uniprot O43741 75-163

8. Domain d2f15a1: 2f15 A:75-163 [146993]

Details for d2f15a1

PDB Entry: 2f15, 2 Å

PDB Description: Glycogen-Binding Domain Of The Amp-Activated Protein Kinase beta2 Subunit

PDB Compounds: (A:) 5'-AMP-activated protein kinase, beta-2 subunit

SCOPe Domain Sequences for d2f15a1:

Sequence; same for both SEQRES and ATOM records:

>d2f15a1 b.1.18.21 (A:75-163) 5'-AMP-activated protein kinase subunit beta-2 {Human (Homo sapiens) [TaxId: 9606]}
qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv
hdpsepvvtsqlgtinnlihvkksdfevf

Timeline for d2f15a1:

• d2f15a1 first appeared in SCOP 1.75
  
• d2f15a1 appears in SCOPe 2.04
  
• d2f15a1 appears in SCOPe 2.06
  
• d2f15a1 appears in the current release, SCOPe 2.08