Lineage for d2f15a1 (2f15 A:75-163)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771012Family b.1.18.21: AMPK-beta glycogen binding domain-like [158886] (4 proteins)
    lacks the N-terminal strand (A) and contains a beta-hairpin insertion in the C-terminal strand (G)
  6. 1771017Protein 5'-AMP-activated protein kinase subunit beta-2 [158887] (2 species)
  7. 1771018Species Human (Homo sapiens) [TaxId:9606] [158888] (1 PDB entry)
    Uniprot O43741 75-163
  8. 1771019Domain d2f15a1: 2f15 A:75-163 [146993]

Details for d2f15a1

PDB Entry: 2f15 (more details), 2 Å

PDB Description: Glycogen-Binding Domain Of The Amp-Activated Protein Kinase beta2 Subunit
PDB Compounds: (A:) 5'-AMP-activated protein kinase, beta-2 subunit

SCOPe Domain Sequences for d2f15a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f15a1 b.1.18.21 (A:75-163) 5'-AMP-activated protein kinase subunit beta-2 {Human (Homo sapiens) [TaxId: 9606]}
qarptvirwseggkevfisgsfnnwstkiplikshndfvaildlpegehqykffvdgqwv
hdpsepvvtsqlgtinnlihvkksdfevf

SCOPe Domain Coordinates for d2f15a1:

Click to download the PDB-style file with coordinates for d2f15a1.
(The format of our PDB-style files is described here.)

Timeline for d2f15a1: