SCOP 1.75: Domain d2emta1: 2emt A:88-198

Lineage for d2emta1 (2emt A:88-198)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
   core: 3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.11.2: Second domain of FERM [47031] (1 family)

5. Family a.11.2.1: Second domain of FERM [47032] (8 proteins)

6. Protein Radixin [47035] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [47036] (10 PDB entries)

8. Domain d2emta1: 2emt A:88-198 [146928]
   Other proteins in same PDB: d2emta2, d2emta3, d2emtb2, d2emtb3
   automatically matched to d1gc6a1

Details for d2emta1

PDB Entry: 2emt, 2.8 Å

PDB Description: crystal structure analysis of the radixin ferm domain complexed with adhesion molecule psgl-1

PDB Compounds: (A:) Radixin

SCOP Domain Sequences for d2emta1:

Sequence; same for both SEQRES and ATOM records:

>d2emta1 a.11.2.1 (A:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

Timeline for d2emta1:

• d2emta1 is new in SCOP 1.75
  
• d2emta1 appears in SCOPe 2.01
  
• d2emta1 appears in the current release, SCOPe 2.08