Lineage for d2ehib1 (2ehi B:4-148)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800749Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 800938Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 800939Family b.42.2.1: Ricin B-like [50371] (10 proteins)
  6. 800965Protein Hemagglutinin component Ha1 [101784] (2 species)
  7. 800971Species Clostridium botulinum [TaxId:1491] [159147] (3 PDB entries)
  8. 800982Domain d2ehib1: 2ehi B:4-148 [146834]
    automatically matched to d1qxma1
    complexed with sia

Details for d2ehib1

PDB Entry: 2ehi (more details), 2.2 Å

PDB Description: HA1 subcomponent of botulinum type C progenitor toxin complexed with N-acetylneuramic acid
PDB Compounds: (B:) Main hemagglutinin component

SCOP Domain Sequences for d2ehib1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ehib1 b.42.2.1 (B:4-148) Hemagglutinin component Ha1 {Clostridium botulinum [TaxId: 1491]}
tnandlrnnevffispsnntnkvldkisqsevklwnklsganqkwrliydtnkqaykikv
mdntsliltwnaplssvsvktdtngdnqywyllqnyisrnviirnymnpnlvlqyniddt
lmvstqtsssnqffkfsnciyealn

SCOP Domain Coordinates for d2ehib1:

Click to download the PDB-style file with coordinates for d2ehib1.
(The format of our PDB-style files is described here.)

Timeline for d2ehib1:

  • d2ehib1 is new in SCOP 1.75
  • d2ehib1 became obsolete in SCOPe 2.01

View in 3D
Domains from same chain:
(mouse over for more information)
d2ehib2