![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.7: Replication terminator protein (RTP) [46807] (1 protein) |
![]() | Protein Replication terminator protein (RTP) [46808] (1 species) contains long helix in the C-terminal extension; forms dimer similar to the LysR-like dimer |
![]() | Species Bacillus subtilis [TaxId:1423] [46809] (6 PDB entries) |
![]() | Domain d2efwb1: 2efw B:8-122 [146821] automatically matched to d1j0rb_ mutant |
PDB Entry: 2efw (more details), 2.5 Å
SCOP Domain Sequences for d2efwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2efwb1 a.4.5.7 (B:8-122) Replication terminator protein (RTP) {Bacillus subtilis [TaxId: 1423]} stgflvkqraflklymitmteqerlyglkllevlrsefkeigfkpnhtevyrslhelldd gilkqikvkkegaklqevvlyqfkdyeaaklykkqlkveldrskkliekalsdnf
Timeline for d2efwb1: