Lineage for d2ef7a1 (2ef7 A:1-127)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550319Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2550320Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2550321Family d.37.1.1: CBS-domain pair [54632] (21 proteins)
    Pfam PF00571; pairs of CBS domains dimerize to form a stable globular domain, a.k.a. Bateman domain
  6. 2550468Protein Uncharacterized protein ST2348 [160161] (1 species)
  7. 2550469Species Sulfolobus tokodaii [TaxId:111955] [160162] (1 PDB entry)
    Uniprot Q96Y20 1-127
  8. 2550470Domain d2ef7a1: 2ef7 A:1-127 [146810]
    Other proteins in same PDB: d2ef7b_

Details for d2ef7a1

PDB Entry: 2ef7 (more details), 2.1 Å

PDB Description: Crystal structure of ST2348, a hypothetical protein with CBS domains from Sulfolobus tokodaii strain7
PDB Compounds: (A:) Hypothetical protein ST2348

SCOPe Domain Sequences for d2ef7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ef7a1 d.37.1.1 (A:1-127) Uncharacterized protein ST2348 {Sulfolobus tokodaii [TaxId: 111955]}
meeeivkeymktqvisvtkdaklndiakvmteknigsvivvdgnkpvgiiterdivkaig
kgksletkaeefmtaslitiredspitgalalmrqfnirhlpvvddkgnlkgiisirdit
raiddmf

SCOPe Domain Coordinates for d2ef7a1:

Click to download the PDB-style file with coordinates for d2ef7a1.
(The format of our PDB-style files is described here.)

Timeline for d2ef7a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ef7b_