SCOPe 2.06: Domain d2ef1b_: 2ef1 B:

Lineage for d2ef1b_ (2ef1 B:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.0: automated matches [191355] (1 protein)
   not a true family

6. Protein automated matches [190390] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187252] (1 PDB entry)

8. Domain d2ef1b_: 2ef1 B: [146808]
   Other proteins in same PDB: d2ef1a1
   automated match to d1isfa_
   complexed with epe

Details for d2ef1b_

PDB Entry: 2ef1, 2.4 Å

PDB Description: Crystal structure of the extracellular domain of human CD38

PDB Compounds: (B:) ADP-ribosyl cyclase 1

SCOPe Domain Sequences for d2ef1b_:

Sequence, based on SEQRES records:

>d2ef1b_ c.23.14.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcnitee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefn
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgs
vevhnlqpekvqtleawvihggredsrdlcqdptikelesiiskrniqfsckniyrpdkf
lqcvk

Sequence, based on observed residues (ATOM records):

>d2ef1b_ c.23.14.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rwrqtwsgpgttkrfpetvlarcvkyteihpemrhvdcqsvwdafkgafiskhpcnitee
dyqplmklgtqtvpcnkillwsrikdlahqftqvqrdmftledtllgyladdltwcgefn
tskinyqscpdwrkdcsnnpvsvfwktvsrrfaeaacdvvhvmlngsrskifdknstfgs
vevhnlqpekvqtleawvihrdlcqdptikelesiiskrniqfsckniyrpdkflqcvk

Timeline for d2ef1b_:

• d2ef1b_ first appeared in SCOP 1.75, called d2ef1b1
  
• d2ef1b_ appears in SCOPe 2.05
  
• d2ef1b_ appears in SCOPe 2.07
  
• d2ef1b_ appears in the current release, SCOPe 2.08