Lineage for d2ecqa_ (2ecq A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1006039Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1006040Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1006041Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)
  6. 1006253Protein automated matches [190054] (7 species)
    not a true protein
  7. 1006292Species Thermus thermophilus [TaxId:300852] [187272] (4 PDB entries)
  8. 1006293Domain d2ecqa_: 2ecq A: [146791]
    automated match to d1ve1a1
    complexed with 3hl, plp

Details for d2ecqa_

PDB Entry: 2ecq (more details), 1.9 Å

PDB Description: Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase Complexed with 3-Hydroxylactate
PDB Compounds: (A:) O-acetylserine (Thiol)-lyase

SCOPe Domain Sequences for d2ecqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ecqa_ c.79.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 300852]}
mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
ya

SCOPe Domain Coordinates for d2ecqa_:

Click to download the PDB-style file with coordinates for d2ecqa_.
(The format of our PDB-style files is described here.)

Timeline for d2ecqa_: