Lineage for d2ecqa1 (2ecq A:1-302)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 844422Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 844423Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 844424Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 844528Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 844560Species Thermus thermophilus [TaxId:274] [142743] (4 PDB entries)
    Uniprot Q5SLE6 1-302
  8. 844562Domain d2ecqa1: 2ecq A:1-302 [146791]
    automatically matched to d1ve1a1
    complexed with 3hl, plp

Details for d2ecqa1

PDB Entry: 2ecq (more details), 1.9 Å

PDB Description: Crystal Structure of T.th. HB8 O-acetylserine sulfhydrylase Complexed with 3-Hydroxylactate
PDB Compounds: (A:) O-acetylserine (Thiol)-lyase

SCOP Domain Sequences for d2ecqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ecqa1 c.79.1.1 (A:1-302) O-acetylserine sulfhydrylase (Cysteine synthase) {Thermus thermophilus [TaxId: 274]}
mrvegaigktpvvrlakvvepdmaevwvkleglnpggsikdrpawymikdaeergilrpg
sgqviveptsgntgiglamiaasrgyrliltmpaqmseerkrvlkafgaelvltdperrm
laareealrlkeelgafmpdqfknpanvrahyettgpelyealegridafvygsgtggti
tgvgrylkeriphvkviaveparsnvlsggkmgqhgfqgmgpgfipenldlslldgviqv
weedafplarrlareeglflgmssggivwaalqvarelgpgkrvacispdggwkylstpl
ya

SCOP Domain Coordinates for d2ecqa1:

Click to download the PDB-style file with coordinates for d2ecqa1.
(The format of our PDB-style files is described here.)

Timeline for d2ecqa1: