Lineage for d2ec9l2 (2ec9 L:87-142)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701322Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 1701323Family g.3.11.1: EGF-type module [57197] (23 proteins)
  6. 1701750Protein automated matches [190092] (1 species)
    not a true protein
  7. 1701751Species Human (Homo sapiens) [TaxId:9606] [187310] (66 PDB entries)
  8. 1701799Domain d2ec9l2: 2ec9 L:87-142 [146787]
    Other proteins in same PDB: d2ec9h_, d2ec9l1, d2ec9l3, d2ec9u_
    automated match to d2a2ql2
    complexed with 24x, aso, ca, fuc

Details for d2ec9l2

PDB Entry: 2ec9 (more details), 2 Å

PDB Description: Crystal structure analysis of human Factor VIIa , Souluble tissue factor complexed with BCX-3607
PDB Compounds: (L:) Coagulation factor VII

SCOPe Domain Sequences for d2ec9l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ec9l2 g.3.11.1 (L:87-142) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dqlicvnenggceqycsdhtgtkrscrchegyslladgvsctptveypcgkipile

SCOPe Domain Coordinates for d2ec9l2:

Click to download the PDB-style file with coordinates for d2ec9l2.
(The format of our PDB-style files is described here.)

Timeline for d2ec9l2: