Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.110: Profilin-like [55769] (10 superfamilies) core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha |
Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families) alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices |
Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins) Pfam PF03259 |
Protein automated matches [190414] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries) |
Domain d2e8jb_: 2e8j B: [146727] automated match to d2b95a1 |
PDB Entry: 2e8j (more details)
SCOPe Domain Sequences for d2e8jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e8jb_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi dpqndltflrirskkneimvapdkdyfliviqnpte
Timeline for d2e8jb_: