SCOPe 2.08: Domain d2e8jb_: 2e8j B:

Lineage for d2e8jb_ (2e8j B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.7: Roadblock/LC7 domain [103196] (2 families)
   alpha-beta(2)-alpha-beta(3)-alpha; structurally most similar to the SNARE-like superfamily with a circular permutation of the terminal helices

5. Family d.110.7.1: Roadblock/LC7 domain [103197] (5 proteins)
   Pfam PF03259

6. Protein automated matches [190414] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187290] (12 PDB entries)

8. Domain d2e8jb_: 2e8j B: [146727]
   automated match to d2b95a1

Details for d2e8jb_

PDB Entry: 2e8j

PDB Description: solution structure of dynein light chain 2a

PDB Compounds: (B:) Dynein light chain 2A, cytoplasmic

SCOPe Domain Sequences for d2e8jb_:

Sequence; same for both SEQRES and ATOM records:

>d2e8jb_ d.110.7.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
dpqndltflrirskkneimvapdkdyfliviqnpte

Timeline for d2e8jb_:

• d2e8jb_ first appeared in SCOP 1.75, called d2e8jb1
  
• d2e8jb_ appears in SCOPe 2.07