![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
![]() | Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (1 family) ![]() possible distant homologue of the type I KH domain lacking the KH motif |
![]() | Family d.52.7.1: Ribosome-binding factor A, RbfA [89920] (1 protein) |
![]() | Protein Ribosome-binding factor A, RbfA [89921] (5 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [160238] (1 PDB entry) Uniprot Q8N0V3 86-201 |
![]() | Domain d2e7ga1: 2e7g A:86-201 [146701] |
PDB Entry: 2e7g (more details)
SCOPe Domain Sequences for d2e7ga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e7ga1 d.52.7.1 (A:86-201) Ribosome-binding factor A, RbfA {Human (Homo sapiens) [TaxId: 9606]} rkedharlralngllykaltdllctpevsqelydlnvelskvsltpdfsacraywkttls aeqnahmeavlqrsaahmrhllmsqqtlrnvppivfvqdkgnaalaeldqllavad
Timeline for d2e7ga1: