Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) |
Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein) |
Protein Ribosomal protein L11, C-terminal domain [46908] (6 species) |
Species Thermus thermophilus [TaxId:274] [158350] (15 PDB entries) Uniprot P36238 70-139! Uniprot P36238 71-137 |
Domain d2e34a1: 2e34 A:70-139 [146670] Other proteins in same PDB: d2e34a2 automatically matched to 2HGJ L:70-139 |
PDB Entry: 2e34 (more details)
SCOPe Domain Sequences for d2e34a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e34a1 a.4.7.1 (A:70-139) Ribosomal protein L11, C-terminal domain {Thermus thermophilus [TaxId: 274]} ktppasylirkaaglekgahkpgrekvgritweqvleiakqkmpdlnttdleaaarmiag sarsmgvevv
Timeline for d2e34a1: