Lineage for d2e2ub1 (2e2u B:212-628)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 795365Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 795366Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
  5. 795367Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 proteins)
  6. 795368Protein Copper amine oxidase, domain 3 [50000] (4 species)
  7. 795369Species Arthrobacter globiformis [TaxId:1665] [50003] (39 PDB entries)
    Uniprot P46881 9-628
  8. 795388Domain d2e2ub1: 2e2u B:212-628 [146661]
    Other proteins in same PDB: d2e2ua2, d2e2ua3, d2e2ub2, d2e2ub3
    automatically matched to d1av4a1
    complexed with 4hl, cu, oty

Details for d2e2ub1

PDB Entry: 2e2u (more details), 1.68 Å

PDB Description: Substrate Schiff-base analogue of copper amine oxidase from Arthrobacter globiformis formed with 4-hydroxybenzylhydrazine
PDB Compounds: (B:) phenylethylamine oxidase

SCOP Domain Sequences for d2e2ub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2e2ub1 b.30.2.1 (B:212-628) Copper amine oxidase, domain 3 {Arthrobacter globiformis [TaxId: 1665]}
plrttqkpisitqpegpsftvtggnhiewekwsldvgfdvregvvlhniafrdgdrlrpi
inrasiaemvvpygdpspirswqnyfdtgeylvgqyanslelgcdclgditylspvisda
fgnpreirngicmheedwgilakhsdlwsginytrrnrrmvisffttignydygfywyly
ldgtiefeakatgvvftsafpeggsdnisqlapglgapfhqhifsarldmaidgftnrve
eedvvrqtmgpgnergnafsrkrtvltreseavreadartgrtwiisnpesknrlnepvg
yklhahnqptlladpgssiarraafatkdlwvtryadderyptgdfvnqhsggaglpsyi
aqdrdidgqdivvwhtfglthfprvedwpimpvdtvgfklrpegffdrspvldvpan

SCOP Domain Coordinates for d2e2ub1:

Click to download the PDB-style file with coordinates for d2e2ub1.
(The format of our PDB-style files is described here.)

Timeline for d2e2ub1: