SCOP 1.75: Domain d2dznc1: 2dzn C:3-228

Lineage for d2dznc1 (2dzn C:3-228)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (1 family)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (17 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein 26S proteasome non-ATPase regulatory subunit 10, gankyrin [102881] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102883] (4 PDB entries)

8. Domain d2dznc1: 2dzn C:3-228 [146618]
   automatically matched to d1ixva_

Details for d2dznc1

PDB Entry: 2dzn, 2.2 Å

PDB Description: Crystal structure analysis of yeast Nas6p complexed with the proteasome subunit, rpt3

PDB Compounds: (C:) Probable 26S proteasome regulatory subunit p28

SCOP Domain Sequences for d2dznc1:

Sequence; same for both SEQRES and ATOM records:

>d2dznc1 d.211.1.1 (C:3-228) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nyplhqacmeneffkvqellhskpslllqkdqdgriplhwsvsfqaheitsfllskmenv
nlddypddsgwtpfhiacsvgnlevvkslydrplkpdlnkitnqgvtclhlavgkkwfev
sqfliengasvrikdkfnqiplhraasvgslkliellcglgksavnwqdkqgwtplfhal
aeghgdaavllvekygaeydlvdnkgakaedvalneqvkkfflnnv

Timeline for d2dznc1:

• d2dznc1 is new in SCOP 1.75
  
• d2dznc1 is called d2dznc_ in SCOPe 2.01
  
• d2dznc1 appears in the current release, SCOPe 2.08, called d2dznc_