Lineage for d2dyjb1 (2dyj B:4-92)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 860188Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
    core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta
  4. 860331Superfamily d.52.7: Ribosome-binding factor A, RbfA [89919] (1 family) (S)
    possible distant homologue of the type I KH domain lacking the KH motif
  5. 860332Family d.52.7.1: Ribosome-binding factor A, RbfA [89920] (1 protein)
  6. 860333Protein Ribosome-binding factor A, RbfA [89921] (5 species)
  7. 860342Species Thermus thermophilus [TaxId:274] [160239] (2 PDB entries)
    Uniprot Q5SJV1 4-94
  8. 860344Domain d2dyjb1: 2dyj B:4-92 [146614]
    automatically matched to 2DYJ A:4-94

Details for d2dyjb1

PDB Entry: 2dyj (more details), 1.84 Å

PDB Description: Crystal structure of ribosome-binding factor A from Thermus thermophilus HB8
PDB Compounds: (B:) ribosome-binding factor a

SCOP Domain Sequences for d2dyjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dyjb1 d.52.7.1 (B:4-92) Ribosome-binding factor A, RbfA {Thermus thermophilus [TaxId: 274]}
gkahleaqlkralaeeiqaledprlflltveavrlskdgsvlsvyveafreeegalrals
raerrlvaalarrvrmrrlprleflpwra

SCOP Domain Coordinates for d2dyjb1:

Click to download the PDB-style file with coordinates for d2dyjb1.
(The format of our PDB-style files is described here.)

Timeline for d2dyjb1: