SCOPe 2.07: Domain d2dy1a5: 2dy1 A:570-665

Lineage for d2dy1a5 (2dy1 A:570-665)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.11: EF-G C-terminal domain-like [54980] (4 families)

5. Family d.58.11.1: EF-G/eEF-2 domains III and V [54981] (3 proteins)
   domain III structure is lacking some of the superfamily characters and is often disordered in crystals

6. Protein Elongation factor G (EF-G) [54982] (2 species)
   domain III is seen in 1FNM but disordered in the most of other PDB entries

7. Species Thermus thermophilus, EF-G-2 [TaxId:274] [143371] (2 PDB entries)
   Uniprot Q5SI76 371-447! Uniprot Q5SI76 563-658
   TTHA1498

8. Domain d2dy1a5: 2dy1 A:570-665 [146611]
   Other proteins in same PDB: d2dy1a1, d2dy1a2, d2dy1a3, d2dy1a6
   automated match to d1wdta4
   complexed with gtp, mg

Details for d2dy1a5

PDB Entry: 2dy1, 1.6 Å

PDB Description: Crystal structure of EF-G-2 from Thermus thermophilus

PDB Compounds: (A:) Elongation factor G

SCOPe Domain Sequences for d2dy1a5:

Sequence; same for both SEQRES and ATOM records:

>d2dy1a5 d.58.11.1 (A:570-665) Elongation factor G (EF-G) {Thermus thermophilus, EF-G-2 [TaxId: 274]}
vllepiyrlkvlapqervgdvlsdlqarrgrilgmeqegalsvvhaevplaevleyykal
pgltggagaytlefshyaevpphlaqrivqeraqeg

Timeline for d2dy1a5:

• d2dy1a5 first appeared in SCOP 1.75
  
• d2dy1a5 appears in SCOPe 2.06
  
• d2dy1a5 appears in the current release, SCOPe 2.08