Lineage for d2dswa2 (2dsw A:240-307)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941865Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) (S)
  5. 2941866Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)
  6. 2942022Protein Signal processing protein (SPC-40, MGP-40) [89882] (5 species)
    secreted during involution
  7. 2942056Species Sheep (Ovis aries) [TaxId:9940] [109621] (17 PDB entries)
    Uniprot Q6TMG6
  8. 2942068Domain d2dswa2: 2dsw A:240-307 [146568]
    Other proteins in same PDB: d2dswa1
    automated match to d1sr0a2

Details for d2dswa2

PDB Entry: 2dsw (more details), 2.8 Å

PDB Description: binding of chitin-like polysaccharides to protective signalling factor: crystal structure of the complex of signalling protein from sheep (sps-40) with a pentasaccharide at 2.8 a resolution
PDB Compounds: (A:) Chitinase-3-like protein 1

SCOPe Domain Sequences for d2dswa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dswa2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]}
fgrsftlassktdvgapvsgpgvpgrftkekgilayyeicdflhgatthrfrdqqvpyat
kgnqwvay

SCOPe Domain Coordinates for d2dswa2:

Click to download the PDB-style file with coordinates for d2dswa2.
(The format of our PDB-style files is described here.)

Timeline for d2dswa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2dswa1