SCOPe 2.08: Domain d2dquh_: 2dqu H:

Lineage for d2dquh_ (2dqu H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d2dquh_: 2dqu H: [146558]
   Other proteins in same PDB: d2dqul2
   automated match to d6shgh_
   complexed with cpd

Details for d2dquh_

PDB Entry: 2dqu, 1.7 Å

PDB Description: Crystal form II: high resolution crystal structure of the complex of the hydrolytic antibody Fab 6D9 and a transition-state analog

PDB Compounds: (H:) immunoglobulin 6d9

SCOPe Domain Sequences for d2dquh_:

Sequence, based on SEQRES records:

>d2dquh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggglvkpggslklscaasgftfsnyamswvrqtpekrlewvvsissggsiyyl
dsvkgrftvsrdnarnilylqmtslrsedtamyfcarvshydgsrdwyfdvwgagtsvtv
ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Sequence, based on observed residues (ATOM records):

>d2dquh_ b.1.1.1 (H:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggglvkpggslklscaasgftfsnyamswvrqtpekrlewvvsissggsiyyl
dsvkgrftvsrdnarnilylqmtslrsedtamyfcarvshydgsrdwyfdvwgagtsvtv
ssakttppsvyplapgsaansmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpsstwpsetvtcnvahpasstkvdkkivprdc

Timeline for d2dquh_:

• d2dquh_ first appeared in SCOP 1.75, called d2dquh1
  
• d2dquh_ was called d2dquh1 in SCOPe 2.07