Lineage for d2doaa1 (2doa A:8-98)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 763060Family a.4.5.81: ELL N2 domain-like [158329] (1 protein)
    PfamB PB026212; includes recent PDB entry 2e5n
  6. 763061Protein RNA polymerase II elongation factor ELL [158330] (1 species)
  7. 763062Species Human (Homo sapiens) [TaxId:9606] [158331] (1 PDB entry)
    Uniprot P55199 197-297
  8. 763063Domain d2doaa1: 2doa A:8-98 [146548]

Details for d2doaa1

PDB Entry: 2doa (more details)

PDB Description: solution structure of the helical domain in human eleven-nineteen lysine-rich leukemia protein ell
PDB Compounds: (A:) RNA polymerase II elongation factor ELL

SCOP Domain Sequences for d2doaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2doaa1 a.4.5.81 (A:8-98) RNA polymerase II elongation factor ELL {Human (Homo sapiens) [TaxId: 9606]}
vsqrpfrdrvlhllalrpyrkaelllrlqkdgltqadkdaldgllqqvanmsakdgtctl
qdcmykdvqkdwpgysegdqqllkrvlvrkl

SCOP Domain Coordinates for d2doaa1:

Click to download the PDB-style file with coordinates for d2doaa1.
(The format of our PDB-style files is described here.)

Timeline for d2doaa1: