SCOPe 2.06: Domain d2dlxa1: 2dlx A:8-147

Lineage for d2dlxa1 (2dlx A:8-147)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.24: UAS domain [159589] (1 protein)
   SMART 00594

6. Protein UBX domain-containing protein 7 [159590] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [159591] (1 PDB entry)
   Uniprot O94888 131-270

8. Domain d2dlxa1: 2dlx A:8-147 [146543]
   Other proteins in same PDB: d2dlxa2, d2dlxa3

Details for d2dlxa1

PDB Entry: 2dlx

PDB Description: solution structure of the uas domain of human ubx domain-containing protein 7

PDB Compounds: (A:) UBX domain-containing protein 7

SCOPe Domain Sequences for d2dlxa1:

Sequence; same for both SEQRES and ATOM records:

>d2dlxa1 c.47.1.24 (A:8-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]}
idkklttladlfrppidlmhkgsfetakecgqmqnkwlminiqnvqdfacqclnrdvwsn
eavkniirehfifwqvyhdseegqryiqfyklgdfpyvsildprtgqklvewhqldvssf
ldqvtgflgehgqldglsss

Timeline for d2dlxa1:

• d2dlxa1 first appeared in SCOP 1.75
  
• d2dlxa1 appears in SCOPe 2.05
  
• d2dlxa1 appears in SCOPe 2.07
  
• d2dlxa1 appears in the current release, SCOPe 2.08