SCOPe 2.06: Domain d2colb_: 2col B:

Lineage for d2colb_ (2col B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein automated matches [190064] (21 species)
   not a true protein

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [225045] (4 PDB entries)

8. Domain d2colb_: 2col B: [146420]
   automated match to d1cmga_
   complexed with ca, mg, pop

Details for d2colb_

PDB Entry: 2col, 2.2 Å

PDB Description: Crystal structure analysis of CyaA/C-Cam with Pyrophosphate

PDB Compounds: (B:) calmodulin

SCOPe Domain Sequences for d2colb_:

Sequence; same for both SEQRES and ATOM records:

>d2colb_ a.39.1.5 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
tdseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvny
eefvqmm

Timeline for d2colb_:

• d2colb_ first appeared in SCOP 1.75, called d2colb1
  
• d2colb_ appears in SCOPe 2.05
  
• d2colb_ appears in SCOPe 2.07
  
• d2colb_ appears in the current release, SCOPe 2.08