Lineage for d2co5b1 (2co5 B:5-93)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 761139Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 761866Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) (S)
    contains a small beta-sheet (wing)
  5. 762800Family a.4.5.48: F93-like [109674] (3 proteins)
    contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers
  6. 762805Protein STIV F93 [158292] (1 species)
    different dimerization mode than SSV1 F93
  7. 762806Species Sulfolobus turreted icosahedral virus [TaxId:269145] [158293] (1 PDB entry)
    Uniprot Q6Q0J9 5-93
  8. 762808Domain d2co5b1: 2co5 B:5-93 [146419]
    automatically matched to 2CO5 A:5-93

Details for d2co5b1

PDB Entry: 2co5 (more details), 2.2 Å

PDB Description: f93 from stiv, a winged-helix dna-binding protein
PDB Compounds: (B:) viral protein f93

SCOP Domain Sequences for d2co5b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2co5b1 a.4.5.48 (B:5-93) STIV F93 {Sulfolobus turreted icosahedral virus [TaxId: 269145]}
kymrinyyiilkvlvingsrlekkrlrseilkrfdidisdgvlyplidsliddkilreee
apdgkvlfltekgmkefeelheffkkivc

SCOP Domain Coordinates for d2co5b1:

Click to download the PDB-style file with coordinates for d2co5b1.
(The format of our PDB-style files is described here.)

Timeline for d2co5b1: