SCOPe 2.05: Domain d2co5a1: 2co5 A:5-93

Lineage for d2co5a1 (2co5 A:5-93)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.48: F93-like [109674] (4 proteins)
   contains long helix in the C-terminal extension; forms dimer similar to the RTP and LysR dimers

6. Protein STIV F93 [158292] (1 species)
   different dimerization mode than SSV1 F93

7. Species Sulfolobus turreted icosahedral virus [TaxId:269145] [158293] (1 PDB entry)
   Uniprot Q6Q0J9 5-93

8. Domain d2co5a1: 2co5 A:5-93 [146418]
   Other proteins in same PDB: d2co5b_
   protein/DNA complex

Details for d2co5a1

PDB Entry: 2co5, 2.2 Å

PDB Description: f93 from stiv, a winged-helix dna-binding protein

PDB Compounds: (A:) viral protein f93

SCOPe Domain Sequences for d2co5a1:

Sequence; same for both SEQRES and ATOM records:

>d2co5a1 a.4.5.48 (A:5-93) STIV F93 {Sulfolobus turreted icosahedral virus [TaxId: 269145]}
kymrinyyiilkvlvingsrlekkrlrseilkrfdidisdgvlyplidsliddkilreee
apdgkvlfltekgmkefeelheffkkivc

Timeline for d2co5a1:

• d2co5a1 first appeared in SCOP 1.75
  
• d2co5a1 appears in SCOPe 2.04
  
• d2co5a1 appears in SCOPe 2.06
  
• d2co5a1 appears in the current release, SCOPe 2.08