Lineage for d2cmza1 (2cmz A:1-409)

  1. Root: SCOPe 2.06
  2. 2243857Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2250688Fold e.76: Viral glycoprotein ectodomain-like [161007] (1 superfamily)
    complex fold; contains three rigid, mostly-beta domains and an alpha-helical region, acting as a conformatiomal switch ("fusion stalk")
  4. 2250689Superfamily e.76.1: Viral glycoprotein ectodomain-like [161008] (3 families) (S)
  5. 2250718Family e.76.1.2: Spike glycoprotein-like [161012] (2 proteins)
    Pfam PF00974; Rhabdovirus spike glycoprotein
  6. 2250719Protein Spike glycoprotein [161013] (1 species)
  7. 2250720Species Vesicular stomatitis indiana virus [TaxId:11277] [161014] (1 PDB entry)
    Uniprot P04883 17-425
    representative prefusion form 2CMZ; representative acidic conformation 2J6J
  8. 2250721Domain d2cmza1: 2cmz A:1-409 [146415]
    Other proteins in same PDB: d2cmzb_, d2cmzc_
    complexed with ca, pe4

Details for d2cmza1

PDB Entry: 2cmz (more details), 2.4 Å

PDB Description: crystal structure of vsv-indiana (mudd-summers strain) glycoprotein under its acidic conformation
PDB Compounds: (A:) Spike glycoprotein

SCOPe Domain Sequences for d2cmza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cmza1 e.76.1.2 (A:1-409) Spike glycoprotein {Vesicular stomatitis indiana virus [TaxId: 11277]}
kftivfphnqkgnwknvpsnyhycpsssdlnwhndligtaiqvkmpkshkaiqadgwmch
askwvttcdfrwygpkyitqsirsftpsveqckesieqtkqgtwlnpgfppqscgyatvt
daeavivqvtphhvlvdeytgewvdsqfingkcsnyicptvhnsttwhsdykvkglcdsn
lismditffsedgelsslgkegtgfrsnyfayetggkackmqyckhwgvrlpsgvwfema
dkdlfaaarfpecpegssisapsqtsvdvsliqdverildyslcqetwskiraglpispv
dlsylapknpgtgpaftiingtlkyfetryirvdiaapilsrmvgmisgttterelwddw
apyedveigpngvlrtssgykfplymighgmldsdlhlsskaqvfehph

SCOPe Domain Coordinates for d2cmza1:

Click to download the PDB-style file with coordinates for d2cmza1.
(The format of our PDB-style files is described here.)

Timeline for d2cmza1: